PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC051093.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family TALE
Protein Properties Length: 643aa    MW: 68775.9 Da    PI: 7.0382
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC051093.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.92e-094394761954
                   HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
      Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                   Fe   ++yp+ +++  LAk++gL+ +qV++WF N R +
  EcC051093.20 439 FEHflHPYPTDTDKLMLAKQTGLSRSQVSNWFINARVR 476
                   554459******************************88 PP

2BELL112.91.7e-36306375372
          BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                    e ++kk++L+s+l+eV++rYkqy++q+q+v++sFe+vagl +a+pY++lAlka+S+hF+cLk+aia+q+
  EcC051093.20 306 GEFRRKKSRLISMLDEVCRRYKQYCQQMQAVVASFECVAGLSNAAPYANLALKAMSKHFKCLKNAIADQL 375
                   58899***************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.8E-55240373IPR006563POX domain
PfamPF075261.0E-40245372IPR006563POX domain
PROSITE profilePS5007112.098417480IPR001356Homeobox domain
SMARTSM003893.4E-10420484IPR001356Homeobox domain
CDDcd000864.34E-13420481No hitNo description
SuperFamilySSF466894.71E-17422487IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-27423484IPR009057Homeodomain-like
PfamPF059201.2E-18437476IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006468Biological Processprotein phosphorylation
GO:0006857Biological Processoligopeptide transport
GO:0015074Biological ProcessDNA integration
GO:0048544Biological Processrecognition of pollen
GO:0055114Biological Processoxidation-reduction process
GO:0016020Cellular Componentmembrane
GO:0003677Molecular FunctionDNA binding
GO:0004674Molecular Functionprotein serine/threonine kinase activity
GO:0005215Molecular Functiontransporter activity
GO:0005524Molecular FunctionATP binding
GO:0008270Molecular Functionzinc ion binding
GO:0016491Molecular Functionoxidoreductase activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 643 aa     Download sequence    Send to blast
MSEGFEPYHV PQQSRRDKLR VVVVQNQNHP PSCLVEPTSA SLHGCAGLLP LYDQSLLQPD  60
LLACAGGGHV GGGHNSISLV KEEGGGANLI GFVGGGGGGG GGSSSSSASS YLDPHSTMVI  120
NPSSIGDMGS TSHPLFLYAA SQGIEGNLGN LSQPYNNHNN AGGGEPPLSL AHDSGAGNTG  180
QGLSLSLSSH VGSTRNHHNT LPLELNLQRF GSAAVYGGKA TASGGGGGYM SSPVPLGPFT  240
GYASILKGSR FLRPAQQLLE ELCEAGRAIC TEKMTDDSCA MTEPAMDSLS GGCGIGVDDG  300
CGGDGGEFRR KKSRLISMLD EVCRRYKQYC QQMQAVVASF ECVAGLSNAA PYANLALKAM  360
SKHFKCLKNA IADQLQFTNK AFSQVSQKRD DASRLGTEER VQYAQRAIQN SGYLEHQPVW  420
RPQRGLPERA VTVLRAWLFE HFLHPYPTDT DKLMLAKQTG LSRSQVSNWF INARVRLWKP  480
MVEEIHMLET QQGQKSSQKE DRNVNKSIDQ LPLANSFSSE NPSTSAQRLH DALPKRTRSE  540
LPIAVPMRND ESLNLYHNMS SHPHVAVSES IGGVSSGVSL TLGLHQNNNG MGLSDSFPVN  600
AAQRFGIGLE TTNEGYVVGS FEAQDRHFGR DVFGGQLLHD FVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5bng_A3e-17426484159Homeobox protein Meis2
5bng_B3e-17426484159Homeobox protein Meis2
4xrm_B3e-17426484563Homeobox protein Meis2
4xrm_A3e-17426484563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010037785.10.0PREDICTED: BEL1-like homeodomain protein 9
SwissprotQ9LZM81e-112BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLA0A059A8440.0A0A059A844_EUCGR; Uncharacterized protein
STRINGVIT_08s0007g01290.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-105TALE family protein